Bedienungsanleitung Funkwerk CS410 (Seite 75 von 103) (Englisch)

68173

Zoom out

Zoom in

Vorherige Seite

1/103

Nächste Seite

(max.20characters.Thenentertheseparatemacrocommands.

Amacro’s command stringis limited to 26 characters. Each com

mand or button simulation consists of two characters. You can

therefore only link a maximum of 13 commands together, or, for

example,join 7 commands/ key strokesimulationswith afurther

12 digits.

Commands and keys for macro programming

A macro consists of various commands, orecall flash button strokes, that are compiled into one command sequence

and stored under a defined direct dialing key. When this function key is pressed, the individual commands

contained in the macro are executed one after the other.

The following commands are available for macro programming:

»B« Initiatingacall(sameasliftingthehandset)

»D« Endingacall(sameasreplacingthehandset)

»ELSE« Alternativecommand,ifarequiredcondition(e.g. »IFLA«or»IFLB«)isnotfulfilled.

»IFLA«

»IFLB«

ExecutethismacroonlywhentheLEDforthefirstlevelisoff(»IFLA«)orflashes(»IFLB«). Ifthiscondition

isnotfulfilledtheprocedureisdiscontinued,orresumedafterthecommand»ELSE«(whereavailable).

»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.

»LA« DeactivateLED

»LB« TheLEDflashes

»LE« ActivateLED

»LZ« ActivateLEDfortwoseconds

»n« Dummynumber.

Ifanumber is enteredprior to executionof a macro(orfor example,dialed fromthe telephone) thisnum-

berisusedinplaceofthedummynumberinthemacro.

»P« Pause(1second)inthecommandsequence(betweentwocharacters/commands)

»RE« Re-establishthephone’sidlestate.

Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthis point.

»SE« Activatingthespeaker(normalvolume)

»SA« Activatingthespeaker(lowvolume)

»T« DTMF-Sequenz:allofthefollowingcharacters/digitsaretransferredasDTMFdialing.

»TS« Testingaconnection.

If there is currently no connection active, or an outgoing connection can not be set up (for B. subscriber

busy),executionofthemacroiscanceledatthispoint.

If you wish to incorporate a telephone key into a macro, press the corresponding key during macro programming

(this is indicated, for example by » s5« in the display). All keys used for operating the telephone during macro

programming (e. g. save, change entry position, delete entry or cancel) cannot be incorporated into the macro by

simply actuating them, but need to be linked with the macro by means of the following commands.

»c« ActuationoftheC-button.

»esc« ActuationoftheESC-button.

»f« Actuationofthemenubutton.

»« Actuationoftheleftarrowbutton.

Programming numbers

Missbrauch melden von Frage und/oder Antwort

Libble nimmt den Missbrauch seiner Dienste sehr ernst. Wir setzen uns dafür ein, derartige Missbrauchsfälle gemäß den Gesetzen Ihres Heimatlandes zu behandeln. Wenn Sie eine Meldung übermitteln, überprüfen wir Ihre Informationen und ergreifen entsprechende Maßnahmen. Wir melden uns nur dann wieder bei Ihnen, wenn wir weitere Einzelheiten wissen müssen oder weitere Informationen für Sie haben.

Art des Missbrauchs:

Forenregeln

Um zu sinnvolle Fragen zu kommen halten Sie sich bitte an folgende Spielregeln:

Lesen Sie zuerst die Anleitung;
Schauen Sie nach, ob die Frage bereits gestellt wurde;
Stellen Sie die Frage so deutlich wie nur einigermaßen möglich;
Erwähnen Sie was Sie bereits versucht haben um das Problem zu lösen;
Ist Ihr Problem von einem Besucher gelöst dann lassen Sie ihn / sie wissen in diesem Forum;
Falls Sie reagieren möchten, so verwenden Sie bitte das Antworten- Formular;
Da ihre Frage für alle Besucher sichtbar ist, sollten Sie lieber keine persönliche Daten erwähnen.

Funkwerk CS410 Seite 75

Brauchen Sie Hilfe? Stellen Sie Ihre Frage.

Missbrauch melden von Frage und/oder Antwort

Art des Missbrauchs:

Forenregeln

Neu registrieren

Das Handbuch wird per E-Mail gesendet. Überprüfen Sie ihre E-Mail.

Ihre Frage wurde zu diesem Forum hinzugefügt

Info